PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 902476
Common NameARALYDRAFT_902476
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 589aa    MW: 64538.5 Da    PI: 6.9203
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
902476genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.62.8e-24157258199
             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
             f+k+lt sd++++g +++p++ ae++      ++++ s++l  +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + ++++l+++v+r
  902476 157 FCKTLTASDTSTHGGFSVPRRAAEDCfppldYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDDGKLRLGVRR 257
             99****************************955566778*************************************************..3489999****99 PP

             S CS
      B3  99 k 99 
             +
  902476 258 A 258
             7 PP

2Auxin_resp85.51e-282753471082
  Auxin_resp  10 vFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 +F+ + + +as+s+F++++ k++k ++ ++++GmRfk ++e+ed+serr  G+++g+sdldp+rWp+SkWr+L
      902476 275 AFTTTNHNWASWSNFIIPAPKFLKIVDYPFCIGMRFKARVESEDASERRSPGIITGISDLDPIRWPGSKWRCL 347
                 677777789***************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.79E-42147269IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.5E-39151262IPR015300DNA-binding pseudobarrel domain
CDDcd100177.05E-22155257No hitNo description
SMARTSM010191.9E-22157259IPR003340B3 DNA binding domain
PROSITE profilePS5086313.324157259IPR003340B3 DNA binding domain
PfamPF023623.3E-22157258IPR003340B3 DNA binding domain
PfamPF065071.3E-22275347IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MGGLIDLNVM ETEEDETQTQ TPSGSVSPTS SSSAASASVV SSSSGGGGVC LELWHACAGP  60
LISLPKRGSL VLYFPQGHLE QAPDFSAAIY GLPPHVFCRI LDVKLHAETT TDEVYAQVSL  120
LPESEDIERK VREGIIDVDG GEEDYEVLKR SNTPHMFCKT LTASDTSTHG GFSVPRRAAE  180
DCFPPLDYSQ PRPSQELLAR DLHGLEWRFR HIYRGQPRRH LLTTGWSAFV NKKKLVSGDA  240
VLFLRGDDGK LRLGVRRASQ IEGTLMPYRP IVFSAFTTTN HNWASWSNFI IPAPKFLKIV  300
DYPFCIGMRF KARVESEDAS ERRSPGIITG ISDLDPIRWP GSKWRCLLVR WDDIEANGHQ  360
QRVSPWEIEP SGSISNSGSF VTTGPKRSRI GFSSGKPDIP VSEGIRATDF EESLRFQRVL  420
QGQEIFPGFI NTCSDGGAGA RRGRFKGTEF GDSYGFHKVL QGQETVPAYA ITDHPQHGLS  480
QRNIWCGPFQ NFSTRILPPS VSSSPSSVLI TNSNSPNGRL EDHHGGPGRC RLFGFPLTNE  540
TTAVASATVV PCVEGNSIKG ASAVQSNHHH SQGRDIYAMR DMLLDIAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-97363772361Auxin response factor 1
4ldy_B1e-97363772361Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3603130.0AF360313.1 Arabidopsis thaliana auxin response transcription factor 3 (ETTIN/ARF3) (At2g33860) mRNA, complete cds.
GenBankATU892960.0U89296.1 Arabidopsis thaliana auxin response transcription factor 3 (ARF3) mRNA, complete cds.
GenBankAY0563650.0AY056365.1 Arabidopsis thaliana auxin response transcription factor 3 (At2g33860) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881313.10.0auxin response transcription factor 3
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLD7LGF80.0D7LGF8_ARALL; Auxin response factor
STRINGscaffold_401977.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49242849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein